PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G16270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family YABBY
Protein Properties Length: 195aa    MW: 21417.1 Da    PI: 8.4011
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G16270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY157.89.3e-4961665170
            YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvss 98 
                      + +e+vCyv+CnfCntilavsvP +s++++vtvrCGhCt+llsvnl+  +q  a   +  ++ +++l+e +    ++ + + e   sa +s s+
  LPERR12G16270.1   6 TPAEHVCYVHCNFCNTILAVSVPGNSMLNIVTVRCGHCTNLLSVNLRGLMQHSAPAPQ--DHHHHHLQESMSGCFRDQSGYPEFGLSAASSSSK 97 
                      5789******************************************988755443332..2233333333333333333333333333333333 PP

            YABBY  99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       +l+  +   +    + ++  e+         r   eei+rika+nPdishreafs+aaknWah+P+ihfgl
  LPERR12G16270.1  98 LRLQPPSAAAMVSYSQQNQQLEQALHL---QRRGNGEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 166
                      344444444444444445555544433...345567**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.9E-517166IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSAQITPAEH VCYVHCNFCN TILAVSVPGN SMLNIVTVRC GHCTNLLSVN LRGLMQHSAP  60
APQDHHHHHL QESMSGCFRD QSGYPEFGLS AASSSSKLRL QPPSAAAMVS YSQQNQQLEQ  120
ALHLQRRGNG EEIRRIKANN PDISHREAFS TAAKNWAHYP NIHFGLSPAH EGGKKLVEVD  180
AIPTPSSKKI QGFYS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740181e-145AB274018.1 Oryza sativa Japonica Group OsYABBY6 mRNA for OsYABBY6 protein, complete cds.
GenBankAK0707371e-145AK070737.1 Oryza sativa Japonica Group cDNA clone:J023061C09, full insert sequence.
GenBankAK1049181e-145AK104918.1 Oryza sativa Japonica Group cDNA clone:001-047-F07, full insert sequence.
GenBankCT8291391e-145CT829139.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA051K22, full insert sequence.
GenBankFJ9401951e-145FJ940195.1 Oryza sativa Japonica Group clone KCS385G10 YABBY protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664216.11e-115PREDICTED: protein YABBY 6
SwissprotQ2QM171e-112YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A0D9Y1M01e-145A0A0D9Y1M0_9ORYZ; Uncharacterized protein
STRINGOB12G26050.11e-114(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.25e-42YABBY family protein